PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J01340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 477aa    MW: 52966.1 Da    PI: 6.0404
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J01340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY75.37.3e-24181235358
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                       DgynWrKYGqK+vk+ e +rsY+rCt+ gC++kk +e++++ ++vvei+Y+ +Hnh
  Migut.J01340.1.p 181 DGYNWRKYGQKQVKSPEGSRSYFRCTFYGCTAKK-IECCDRSNRVVEIVYRIHHNH 235
                       9*******************************98.********************* PP

2WRKY95.53.6e-30348405259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK+vkgs++pr+YYrCts+gCpv+k+ ers ++ ++v+i Y+g H+h+
  Migut.J01340.1.p 348 SDGYRWRKYGQKMVKGSPHPRNYYRCTSSGCPVRKQTERSMDNASAVVISYKGVHDHD 405
                       7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182902.62E-19177238IPR003657WRKY domain
SMARTSM007741.0E-22179237IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-20179238IPR003657WRKY domain
PROSITE profilePS5081117.787181238IPR003657WRKY domain
PfamPF031064.1E-17181235IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.2E-30333407IPR003657WRKY domain
PROSITE profilePS5081131.605342407IPR003657WRKY domain
SuperFamilySSF1182901.07E-26342407IPR003657WRKY domain
SMARTSM007741.2E-33347406IPR003657WRKY domain
PfamPF031063.9E-23349404IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
METENNLFSH GEIAEGNSIT AHDVDEGNNH CENFDENDEQ QERVSGSNCA GDGACVHSQS  60
ETLTSVQMSD RSTQSDSEKS PEFLAGISEE VPVEYSPQPP QSGGELKNQV NEEPSNCISG  120
QSSQVEVQLP NGESKLEQST TSGKELQAVE NGILTCFKEQ DKQNSPGPKP LSTVPTLKTP  180
DGYNWRKYGQ KQVKSPEGSR SYFRCTFYGC TAKKIECCDR SNRVVEIVYR IHHNHGPPQE  240
VNCTRENNMP ALPIMPISWN QDRTTHLARH YNDSMTSLQV VDQIHETKHQ DSCGSDETTV  300
TNTREEANGP EYKRRQKRSS ERELVSLSET GKKSKCVVYE TGDVGISSDG YRWRKYGQKM  360
VKGSPHPRNY YRCTSSGCPV RKQTERSMDN ASAVVISYKG VHDHDIPLPR KSNGPKSASV  420
SAANLQNNKS EVYPSQTQWS VDKQGQLSGE SFNLGGDKIS ESPKTLLSIE FEIKPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-23334407174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839864.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLA0A022R5Q00.0A0A022R5Q0_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA91892127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-86WRKY DNA-binding protein 32